PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK27095.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family bZIP
Protein Properties Length: 334aa    MW: 37166.3 Da    PI: 4.2981
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK27095.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_131.44.3e-10177232459
                 XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevakl 59 
                  k+ rr  +NR AA rsR+RKk++++ Le+k+k Le e  +L   l+    e ++l
  KFK27095.1 177 AKKRRRQLRNRDAAVRSRERKKEYVKDLETKSKYLERECLRLGRILDCFAAENQSL 232
                 6999*********************************9988887777777766666 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.6E-12173236No hitNo description
SMARTSM003383.4E-6174238IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.45176233IPR004827Basic-leucine zipper domain
PfamPF001705.1E-11177233IPR004827Basic-leucine zipper domain
SuperFamilySSF579597.74E-11178234No hitNo description
CDDcd147044.08E-17179230No hitNo description
PROSITE patternPS000360181196IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010200Biological Processresponse to chitin
GO:0030968Biological Processendoplasmic reticulum unfolded protein response
GO:0005634Cellular Componentnucleus
GO:0005789Cellular Componentendoplasmic reticulum membrane
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 334 aa     Download sequence    Send to blast
MVEDFSCFDS VVDDDFLVDF DPSLFTDLDP SFFDDLDPPA KVFTRESASP VLEDIESLLM  60
NDEHQDLPEL DQQSVSDFLA DLFVDYHPTS DSATDKVLDL PIVDSPAVGS DSDGSVTGKL  120
PIVDSPTAGS DSDGFVTGKE AQGSSEYIEK KSSETPNDSG SESQDGAEVE GNDDPVAKKR  180
RRQLRNRDAA VRSRERKKEY VKDLETKSKY LERECLRLGR ILDCFAAENQ SLRLCLQKGG  240
NHNASMTRQE SAVLLLESLL LGSLLWYLGS IICQFPQPHT KSQSQSLELE TEEPERLVLS  300
GRESNILLES ITWKSRRCKG SRPRMKQQGM TLVA
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1178197KRRRQLRNRDAAVRSRERKK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00019PBMTransfer from AT1G42990Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006395999.11e-86hypothetical protein EUTSA_v10004635mg
SwissprotQ9C7S05e-59BZP60_ARATH; bZIP transcription factor 60
TrEMBLA0A087GB430.0A0A087GB43_ARAAL; Uncharacterized protein
STRINGAT1G42990.11e-56(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM46342848
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G42990.18e-55basic region/leucine zipper motif 60